SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for YP_008853833.1.41424 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  YP_008853833.1.41424
Domain Number - Region: 37-60
Classification Level Classification E-value
Superfamily Phenylalanine zipper 0.0301
Family Adapter protein APS, dimerisation domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) YP_008853833.1.41424
Sequence length 124
Comment putative predicted protein [Ralstonia phage RSK1]; AA=GCF_000913935.1; RF=na; TAX=1417599; STAX=1417599; NAME=Ralstonia phage RSK1; AL=Complete Genome; RT=Major
Sequence
MTLEHIEAKPLADRFPFRSHRITSSGFARAVVCPEIWTEFREREARLSSTQLAREFWARL
ATFGDAVSEVFRGGFAGGSQAMPFVRRSGLEEFRERHDPISRLMYSLVAVRYAKAMLGAR
KSMV
Download sequence
Identical sequences U6C716
YP_008853833.1.41424 gi|560186068|ref|YP_008853833.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]