SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_000361.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_000361.1.87134
Domain Number 1 Region: 96-259
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 7.32e-65
Family CRAL/TRIO domain 0.000000148
Further Details:      
 
Domain Number 2 Region: 12-89
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 4.69e-19
Family CRAL/TRIO N-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_000361.1.87134
Sequence length 278
Comment alpha-tocopherol transfer protein [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MAEARSQPSAGPQLNALPDHSPLLQPGLAALRRRAREAGVPLAPLPLTDSFLLRFLRARD
FDLDLAWRLLKNYYKWRAECPEISADLHPRSIIGLLKAGYHGVLRSRDPTGSKVLIYRIA
HWDPKVFTAYDVFRVSLITSELIVQEVETQRNGIKAIFDLEGWQFSHAFQITPSVAKKIA
AVLTDSFPLKVRGIHLINEPVIFHAVFSMIKPFLTEKIKERIHMHGNNYKQSLLQHFPDI
LPLEYGGEEFSMEDICQEWTNFIMKSEDYLSSISESIQ
Download sequence
Identical sequences A0A2J8UR10 P49638
ENSP00000260116 1oip_A 1oiz_A 1oiz_B gi|4507723|ref|NP_000361.1| 1oizA 9606.ENSP00000260116 ENSP00000260116 ENSP00000260116 NP_000361.1.87134 NP_000361.1.92137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]