SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001006974.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001006974.1.100692
Domain Number 1 Region: 18-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.22e-23
Family Ribosomal L11/L12e N-terminal domain 0.00041
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 9.29e-18
Family Ribosomal protein L11, C-terminal domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001006974.1.100692
Sequence length 203
Comment 39S ribosomal protein L11, mitochondrial [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MSKLSRVTRTLKKPEAGGVIRSIVRAGQAIPGPPLGPILGQRGVSINQFCKEFNEKTKDI
KEGIPLPTKIFIKPDRTFELKIGQPTISYFLKAAAGIEKGARQTGKEVAGLVSLKHVYEI
ARVKAKDEAFAMQDVPLSSIVRSIIGSARSLGIRVVKDLSVDELAAFQKERAVFLAAQKR
RIWQLRQKLPKSDPNLLHSEVRD
Download sequence
Identical sequences Q5XIE3
10116.ENSRNOP00000027091 ENSRNOP00000027091 ENSRNOP00000027091 NP_001006974.1.100692 NP_001006974.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]