SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001006989.2.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001006989.2.100692
Domain Number 1 Region: 197-335,487-524,562-663
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.46e-29
Family WD40-repeat 0.0025
Further Details:      
 
Domain Number 2 Region: 566-652,754-785,880-1017,1045-1081
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 1.49e-19
Family Quinoprotein alcohol dehydrogenase-like 0.029
Further Details:      
 
Domain Number 3 Region: 34-241
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.00000000266
Family WD40-repeat 0.0083
Further Details:      
 
Weak hits

Sequence:  NP_001006989.2.100692
Domain Number - Region: 361-521
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.000476
Family WD40-repeat 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001006989.2.100692
Sequence length 1125
Comment WD repeat-containing protein 6 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MDAFGDYVWPRATSELILLPVTGLECVGDRLLAGEGPDLLVYNLDFGGHLRMVKRVQNLL
GHYLIHGFRVQPEPKGDLDSEAMIAVFGSKGLRVVKISWGQSHLRELWRSGLWNMSDWIW
DARWLEGNVALALGHNSVVLYDPVIGCMLQDVPCTDRCTLSSACLIGDTWKELTIVAGAV
SNELLVWYPATALPDNKPVAPDRRVSGHVGVIFSMSYLESKGLLATASEDRSVRIWKVGD
LRVPGGRVQNIGHCFGHSARVWQVKLLENYLISAGEDCVCLVWSHEGEILQAFRGHQGRG
IRAIAAHERQTWVITGGDDSGIRLWHLVGRGYPGLGVSSLSFKSPSRPGALKAVTLAGSW
RVLAVTDVGGLYLYDLEVKCWEQLLEDNRFQSYCLLEAAPGPEGFGLCALANGEGLVKVV
PINTPTAAVDQNLFQGKVHSLSWALRGYEELLLLASGPGGVVACLEISAAPTGKAIFVKE
RCRYLLPPSKQRWHTCSAFLPPGDFLVCGDRRGSVLLFPARPCLFKKPGVGPKAITAAEA
PQAGSSSGGSESVVTGLGPVSSLHSLHGKQGVTSVTCHGGYVYSTGRDGSYYQLFVHGGR
LQPVLRQKACRGMNWIAGLRMAPDGSMVVLGFHANEFVVWSPRSHEKLHIVNCGGGHRSW
AFSDTEAAMAFAYLKDGDVMLYRALGGCIRPNVILREGLHGREITCVKRVGTVTLGPEFE
VPNLEHPDSLEPGSEGPGLIDIVITGSEDTTVCVLALPTTTGAAHALTAVCNHISSVRAL
AVWGVGTPGGPQDSHPGLTAQVVSAGGRAEMHCFSLMITPDASTPSRLACHIMHLSSHRL
DEYWDRQRNRHRMIKVDPETRYMSLAICELDSDRPGLGPGPLVAAACSDGAVRLFLLQDS
GRILHLLAETFHHKRCVLKVHSFTHEAPNQRRRLILCSAATDGSIAFWDLTTAMDRGSTT
LEPPAHPGLPYQMGTPCLTVQAHSCGVNSLHTLPTPEGHHLVASGSEDGSLHVFTLAVKM
PELEEADGEAELVPQLCVLDEYSVPCAHAAHVTGIKILSPKLMVSASIDQRLTFWRLGNG
EPTFMNSTVYHVPDVADMDCWPVNPEFGHRCALAGQGLEVYNWYD
Download sequence
Identical sequences Q5XFW6
10116.ENSRNOP00000027411 NP_001006989.2.100692 NP_001006989.2.4139 ENSRNOP00000027411 ENSRNOP00000027411

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]