SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001006999.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001006999.1.4139
Domain Number 1 Region: 6-436
Classification Level Classification E-value
Superfamily ALDH-like 5.89e-126
Family ALDH-like 0.000000000482
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001006999.1.4139
Sequence length 468
Comment aldehyde dehydrogenase family 3 member B1 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MDSFEDKLQQLREAFNAGRTRSAEFRAAQLQGLSHFLRDNKQQLQEALAQDLHKSAFESE
VSEIAISQAEVDLALRNLRSWMKDEKVSKNLATQLDSAFIRKEPFGLVLIIVPWNYPLNL
TLVPLVGAIAAGNCVVLKPSEISKATEKILAEVLPRYLDQSCFAVVLGGPQETGQLLEHR
FDYIFFTGNTYVGKIVMAAAAKHLTPITLELGGKNPCYVDDNCDPQTVANRVAWFRYFNA
GQTCVAPDYVLCSQEMQERLVPALQNAITRFYGDNPQTSPNLGRIINQKHFERLQGLLGC
GRVAIGGQSDEGERYIAPTVLVDVQETEPVMQEEIFGPILPLVTVTNLDEAIEFINRREK
PLALYAFSKRSQVIKQVLARTSSGGFCGNDGFMHMTLSSLPFGGVGTSGMGRYHGKFSFD
TFSNQRACLLRSPGMEKINDLRYPPYTSRNLRVLLVAMEKRCCSCTLL
Download sequence
Identical sequences Q5XI42
10116.ENSRNOP00000023789 NP_001006999.1.100692 NP_001006999.1.4139 XP_006230849.1.100692 XP_008758356.1.100692 ENSRNOP00000023789 ENSRNOP00000023789

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]