SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001012057.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001012057.1.100692
Domain Number 1 Region: 84-513
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.28e-69
Family AAT-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001012057.1.100692
Sequence length 522
Comment alanine aminotransferase 2 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MQRAAVLVRRGSCPRASGPWGRSHSSAAAEASAALKVRPERSPRDRILTLESMNPQVKAV
EYAVRGPIVLKAGEIEMELQRGIKKPFTEVIRANIGDAHAMGQQPITFLRQVMALCTYPN
LLNSPSFPEDAKKRARRILQACGGNSLGSYSASQGVNCIREDVAAFITRRDGVPADPDNI
YLTTGASDGISTILKLLVSGGGKSRTGVMIPIPQYPLYSAVISELDAIQVNYYLDEDNCW
ALNVDELRRALRQAKDHCDPKVLCIINPGNPTGQVQSRKCIEDVIHFAWEEKLFLLADEV
YQDNVYSPDCRFHSFKKVLYQMGPEYSSNVELASFHSTSKGYMGECGYRGGYMEVINLHP
EIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVPGEESFEQFTREKESVLGNLAKKAKLTE
DLFNQVPGIQCNPLQGAMYAFPRILIPAKAVEAAQSHKMAPDMFYCMKLLEETGICVVPG
SGFGQREGTYHFRMTILPPVEKLKTVLHKVKDFHLKFLEKYS
Download sequence
Identical sequences ENSRNOP00000022851 ENSRNOP00000022851 10116.ENSRNOP00000022851 NP_001012057.1.100692 NP_001012057.1.4139 XP_008770627.1.100692 XP_008770628.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]