SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001013228.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001013228.1.4139
Domain Number 1 Region: 17-134
Classification Level Classification E-value
Superfamily FKBP-like 2.75e-34
Family FKBP immunophilin/proline isomerase 0.00016
Further Details:      
 
Domain Number 2 Region: 112-206
Classification Level Classification E-value
Superfamily EF-hand 0.00000000000154
Family Calbindin D9K 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001013228.1.4139
Sequence length 211
Comment peptidyl-prolyl cis-trans isomerase FKBP14 precursor [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MRFFLWNANLTLWVTVLSGALIPEPEVKIEVLQKPFICHRKTKGGDLMLVHYEGYLEKDG
SLFHSTHKHNNGQPVWFTLGILEVLKGWDQGLKGMCVGEKRKLTIPPALGYGKEGKGKIP
PESTLIFNIDLLEIRNGPRSHESFQEMDLNDDWKLSKHEVKVYLQNEFEKHGAVVNESHH
DALVEDIFDKEDEDKDGFISAREFTYVHDEL
Download sequence
Identical sequences Q5XID8
NP_001013228.1.100692 NP_001013228.1.4139 10116.ENSRNOP00000013205 ENSRNOP00000013205 ENSRNOP00000061712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]