SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001013340.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001013340.1.45394
Domain Number 1 Region: 54-151
Classification Level Classification E-value
Superfamily Histone-fold 2.55e-39
Family TBP-associated factors, TAFs 0.0000207
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001013340.1.45394
Sequence length 205
Comment nuclear transcription factor Y subunit beta [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MDGESSTTDASQLGMTGEYMASSHFVLHAQDDEGDDGLNDHEDGNGSKDNLREQDIYLPI
ANVARIMKNAIPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFA
MSTLGFDMYVEPLKLYLQKFREAMKGEKGISTVTVTEGMGDELTDESFANPLPAGIITAD
GQQQNVMVYTTAYQQIPGVQQLQFS
Download sequence
Identical sequences Q5CZV3
7955.ENSDARP00000067071 ENSDARP00000067071 NP_001013340.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]