SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001014424.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001014424.1.92730
Domain Number 1 Region: 874-970
Classification Level Classification E-value
Superfamily Fibronectin type III 7.46e-18
Family Fibronectin type III 0.0011
Further Details:      
 
Domain Number 2 Region: 111-213
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000155
Family Fibronectin type III 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001014424.1.92730
Sequence length 1115
Comment target of Nesh-SH3 isoform 2 precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MLSSLGCLLLCGSIALALGNAQKLPKGKKPSLKVHINTTSDSILLKFLRPNANVKLEGFL
LGYGSNVSPNQYFPLPTEGKFTEAVVDAEPKYLIVVRPAPPPSQKKSCSGKSRPRKPLQL
VVGTLTPSSVFLSWGFLINPHHDWTLPSHCPSDRFYTIRYREKDKEKKWIFQLCPATETI
VENLKPNTVYEFGVKDNIEGGIWSKIFNHKTIVGSKNKVNGKIQSTYDQVHSVPVPRKLI
PLTIIKQVIQNVTHRASTKSPDKTPFGGTILVHLIIPGLNESTVKLPTSIMLEISDALKA
QLAKNETLALPAESKTPEVEKLAGQPVTVTPESVSRSTKPTLSSALDTAETALVLSEKTS
ETARSVLIPEFELPLSTLAPKRFPEFPEAKTAFPLEKPRGSWASSEEPWVVPGAKTSEDS
RVVQPQTATYDVISSSTTSDETEIEIHTATRDPILDSVPPKTSRTAEQPRATLAPIEALF
ESRNVEIFTSPEVRPTTAAPQQTTSIPSTPKRQSTPKPPRVKPAPRQTTSMPPKLKTPHS
RMPAKEPVPKEPLHTTSKPKMPPSPEVADTTSVPKDERLSLKPDPEVTHSETVLPPVTFR
VEPPKTTIAPLETRGIPLIPVISPRPSQEELQTAMEETDQSTQELFTTKIPRTTELAKTT
QAPHRLHTAPVRPRIPGRPHGRPALNKTTTRPDKTKPRGTSHKNGVGTGTKQAPKPPSPG
RNASVDSHATRKPGSVSGTRRPPIPHRHSSTRPVSPERRPLPPNNVTGKPGRAGIVSSSR
VTSPPLKATLHPIGTATARPGAEQKEPTAPASEEEFGTTTDFSSSPTKETDPLGKPRFIG
PHVRYIPKPENKPCSITDSVRRFPTEEATEGNATSPPQNPPTNLTVVTVEGCPSFVILDW
EKPLNDTVTEYEVISRENGSFSGKNKSIQITNQTFSTVENLKPDTSYEFQVKPKNPLGEG
PASNTVAFSTESADPRVSEPISAGRDAIWTERPFNSDSYSECKGKQYVKRTWYKKFVGVQ
LCNSLRYKIYLSDSLTGKFYNIGDQRGHGEDHCQFVDSFLDGRTGQQLTSEQLPTKEGYF
RAVRQEPVQFGEIGGHTQINYVQWYECGTTIPGKW
Download sequence
Identical sequences Q59IW5
ENSMUSP00000093712 NP_001014424.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]