SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001015008.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001015008.1.100692
Domain Number 1 Region: 171-279
Classification Level Classification E-value
Superfamily Elongation factor TFIIS domain 2 1.44e-34
Family Elongation factor TFIIS domain 2 0.0029
Further Details:      
 
Domain Number 2 Region: 3-90
Classification Level Classification E-value
Superfamily Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 4.05e-26
Family Conserved domain common to transcription factors TFIIS, elongin A, CRSP70 0.00000433
Further Details:      
 
Domain Number 3 Region: 304-346
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 4.14e-16
Family Transcriptional factor domain 0.00036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001015008.1.100692
Sequence length 348
Comment transcription elongation factor A protein 3 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MGLEEELLRIAKKLEKMVARKKTEGALDLLKKLNSCQMSIQLLQTTRIGVAVNGVRKHCS
DKEVVSLAKVLIKNWKRLLDSPRTTKGEREAREKAKKKEKGLGSSGWKPEAGLSPPRKKE
GGEPKTRRDSVDSRSSTTSSPKRPSLERSNSSRSKVETPKTPSSPSTPTFAPAVCLLASC
YLTGDSVRDKCVEMLSAALKAEDDFKDYGVNCDKLASEIEDHIYQELKSTDMKYRNRVRS
RISNLKDPRNPGLRRNVLSGTISPELIAKMTAEEMASDELRELRNAMTQEAIREHQMAKT
GGTTTDLLRCSKCKKKNCTYNQVQTRSADEPMTTFVLCNECGNRWKFC
Download sequence
Identical sequences Q5BK74
10116.ENSRNOP00000015776 ENSRNOP00000015776 ENSRNOP00000015776 NP_001015008.1.100692 NP_001015008.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]