SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001015241.3.81976 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001015241.3.81976
Domain Number 1 Region: 22-313,341-583
Classification Level Classification E-value
Superfamily TPR-like 9.48e-144
Family HAT/Suf repeat 0.00000000000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001015241.3.81976
Sequence length 765
Comment suppressor of forked, isoform F [Drosophila melanogaster]; AA=GCF_000001215.4; RF=reference genome; TAX=7227; STAX=7227; NAME=Drosophila melanogaster; AL=Chromosome; RT=Major
Sequence
MSSARDLIKVDIEWGMERLVRAQQVVELRPYDIESWSVMIREAQTRPIHEVRSLYESLVN
VFPTTARYWKLYIEMEMRSRYYERVEKLFQRCLVKILNIDLWKLYLTYVKETKSGLSTHK
EKMAQAYDFALEKIGMDLHSFSIWQDYIYFLRGVEAVGNYAENQKITAVRRVYQKAVVTP
IVGIEQLWKDYIAFEQNINPIISEKMSLERSKDYMNARRVAKELEYHTKGLNRNLPAVPP
TLTKEEVKQVELWKRFITYEKSNPLRTEDTALVTRRVMFATEQCLLVLTHHPAVWHQASQ
FLDTSARVLTEKGVRTSVENISPILCVPVVNQIEWVMAFAWWWAKDVQAAKIFADECANI
LERSINGVLNRNALLYFAYADFEEGRLKYEKVHTMYNKLLQLPDIDPTLVYVQYMKFARR
AEGIKSARSIFKKAREDVRSRYHIFVAAALMEYYCSKDKEIAFRIFELGLKRFGGSPEYV
MCYIDYLSHLNEDNNTRVLFERVLSSGGLSPHKSVEVWNRFLEFESNIGDLSSIVKVERR
RSAVFENLKEYEGKETAQLVDRYKFLDLYPCTSTELKSIGYAENVGIILNKVGGGAQSQN
TGEVETDSEATPPLPRPDFSQMIPFKPRPCAHPGAHPLAGGVFPQPPALAALCATLPPPN
SFRGPFVSVELLFDIFMRLNLPDSAPQPNGDNELSPKIFDLAKSVHWIVDTSTYTGVQHS
VTAVPPRRRRLLPGGDDSDDELQTAVPPSHDIYRLRQLKRFAKSN
Download sequence
Identical sequences P25991
FBpp0112455 FBpp0297502 7227.FBpp0112455 NP_001015241.3.81976 FBpp0112455 FBpp0112455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]