SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001017565.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001017565.1.45394
Domain Number 1 Region: 53-149
Classification Level Classification E-value
Superfamily Histone-fold 3.57e-39
Family TBP-associated factors, TAFs 0.0000211
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001017565.1.45394
Sequence length 204
Comment nuclear transcription factor Y, beta [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MDGDSSTTDTTQLGITGEYMAGGTYVLAQEDDGDESFNDHDDGNGSKDFFREQDIYLPIA
NVARIMKNAVPQTGKIAKDAKECVQECVSEFISFITSEASERCHQEKRKTINGEDILFAM
STLGFDMYVEPLKLYLQKFREAMKGEKGITPVAVGEGLGEDLTDETFTGQLPAGLITADG
QQQNVMVYTTSYQQIPGVQQIQFS
Download sequence
Identical sequences Q561X4
7955.ENSDARP00000057253 ENSDARP00000057253 NP_001017565.1.45394 XP_005168580.1.45394 ENSDARP00000057253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]