SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001017950.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001017950.1.76553
Domain Number 1 Region: 33-97
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000013
Family Ovomucoid domain III-like 0.0058
Further Details:      
 
Domain Number 2 Region: 140-221
Classification Level Classification E-value
Superfamily EF-hand 0.000000000049
Family Calmodulin-like 0.079
Further Details:      
 
Domain Number 3 Region: 227-268
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000188
Family VWC domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001017950.1.76553
Sequence length 307
Comment follistatin-related protein 1 precursor [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MMWRRWLALALVAVAWVHAEEQVRSKSKICANVFCGAGRECAVTEKGEPTCLCIEQCKPH
KRPVCGSNGKTYLNHCELHRDACLTGSKIQVDYDGHCKEKKSVSPSASPVVCYQSNRDEL
RRRIIQWLEAEIIPDGWFSKGSNYSEILDKYFKNFDNGDSRLDSSEFLKFVEQNETAINI
TTYADQENNKLLRGLCVDALIELSDENADWKLSFQEFLKCLNPSFNPPEKKCALEDETYA
DGAETEVDCNRCVCACGNWVCTAMTCDGKNQKGAQTQAEEEMTRYVQELQKHQETAEKSK
RVSTKEI
Download sequence
Identical sequences Q58D84
NP_001017950.1.76553 XP_005200261.1.59421 XP_005905487.1.15283 XP_005971719.1.78601 XP_010843690.1.44457 XP_019843280.1.53367 ENSBTAP00000029886 9913.ENSBTAP00000029886 ENSBTAP00000029886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]