SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001020916.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001020916.1.4139
Domain Number 1 Region: 84-144
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000000114
Family AN1-like Zinc finger 0.0017
Further Details:      
 
Domain Number 2 Region: 5-49
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.000000000353
Family AN1-like Zinc finger 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001020916.1.4139
Sequence length 257
Comment AN1-type zinc finger protein 2B [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MEFPDLGAHCSEPSCQRLDFLPLKCDACSGIFCADHVAYAHHHCGSAYQKDIQVPVCPLC
NVPVPVARGEPPDRAVGEHIDRDCRSDPAQQKRKIFTNKCERSGCRQREMMKLTCDRCGR
NFCIKHRHPLDHDCSGEGHPTSRAGLAAISRAQGLASTSTVPSPSRTLPSSSSPSRATPQ
LPPRTTSPVIALQNGLSEDEALQRALELSLAEAKPQIPSSQEEEDLALAQALSASEAEYQ
QQQAQSRSLKPSNCSLC
Download sequence
Identical sequences Q4KLG9
NP_001020916.1.100692 NP_001020916.1.4139 ENSRNOP00000025219 10116.ENSRNOP00000025219 ENSRNOP00000025219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]