SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001028875.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001028875.1.4139
Domain Number 1 Region: 260-362
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 0.0000000857
Family Deoxycytidylate deaminase-like 0.026
Further Details:      
 
Domain Number 2 Region: 69-186
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 0.000000244
Family Deoxycytidylate deaminase-like 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001028875.1.4139
Sequence length 385
Comment DNA dC-_dU-editing enzyme APOBEC3 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MGPVCLGCSHRRPYSPIRNPLKKLYQQTFYFHFKNVRYAWGRKNNFLCYEVNGMDCALPV
PLRQGVFRKQGHIHAELCFIYWFHDKVLRVLSPMEEFKVTWYMSWSPCSKCAEQVARFLA
AHRNLSLAIFSSRLYYYLRNPNYQQKLCRLIQEGVHVAAMDLPEFKKCWNKFVDNDGQPF
RPWMRLRINFSFYDCKLQEIFSRMNLLREDVFYLQFNNSHRVKPVQNRYYRRKSYLCYQL
ERANGQEPLKGYLLYKKGEQHVEILFLEKMRSMELSQVRITCYLTWSPCPNCARQLAAFK
KDHPDLILRIYTSRLYFYWRKKFQKGLCTLWRSGIHVDVMDLPQFADCWTNFVNPQRPFR
PWNELEKNSWRIQRRLRRIKESWGL
Download sequence
Identical sequences Q3T1K0
NP_001028875.1.100692 NP_001028875.1.4139 ENSRNOP00000034183 ENSRNOP00000034183 10116.ENSRNOP00000034183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]