SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001030533.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001030533.1.59421
Domain Number 1 Region: 2-107
Classification Level Classification E-value
Superfamily FKBP-like 1.28e-42
Family FKBP immunophilin/proline isomerase 0.00000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001030533.1.59421
Sequence length 108
Comment peptidyl-prolyl cis-trans isomerase FKBP1A [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MGVQVETISPGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFVLGKQEVIRGW
EEGVAQMSVGQRAKLTISPDYAYGATGHPGIIPPNATLIFDVELLKLE
Download sequence
Identical sequences P18203
ENSBTAP00000010928 ENSBTAP00000010928 9913.ENSBTAP00000010928 NP_001030533.1.59421 NP_001030533.1.76553 XP_005888021.1.15283 XP_010840093.1.44457 XP_011964259.1.54773 XP_011964260.1.54773 XP_014335109.1.15283 XP_017900246.1.57651 XP_017912652.1.57651 XP_017913131.1.57651 XP_019827725.1.53367 XP_020756551.1.74333

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]