SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001030862.1.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001030862.1.80155
Domain Number 1 Region: 175-342
Classification Level Classification E-value
Superfamily Bet v1-like 1.92e-38
Family STAR domain 0.0035
Further Details:      
 
Domain Number 2 Region: 10-124
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000000196
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001030862.1.80155
Sequence length 733
Comment Pleckstrin homology (PH) and lipid-binding START domains-containing protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MGVSQTDGRMEGWLYTIRHNRFGLQFSRKRYFVLHENNLTSFKSVPSDHNEEPERRASLD
CCIRVTDNGRESFHRKILFIFTLYNTSNHLDQLKLGASSPEEAAKWIRSLQDASQKGFPI
PDCEFFVSHAEKGLVKLDVSKRNRRKNSVDWTNYSSTNYSSTSLNVETNVAPDVIAPSPW
KIFGCQNGLRLFKEAKDWDSRGRHWDDHPAIMAVGVIDGTSEDIFNTLMSLGPLRSEWDF
CFYKGNVVEHLDGHTDIIHLQLYSDWLPWGMNRRDLLLRRYWRREDDGTYVILCHSVYHK
NCPPKKGYVRACVKSGGYVVTPANNGKQSLVKHMVAIDWRSWNLYMRPSSARSITIRVVE
RVAALREMFKAKQGHGFTEFVSGEFLDTKPCLSKINTMPLKTEAKEVDLETMHAEEMDKP
TSARNSLMDLNDASDEFFDVPEPNESTEFDSFIDSSPYSQGHQLKIPTPAGIVKKLQDLA
INKKGYMDLQEVGLEENNTFFYGATLQKDPSLTLPCSWSTADPSTFLIRGNNYLKNQQKV
KAKGTLMQMIGADWISSDKREDDLGGRIGGLVQEYAAKGSPEFFFIVNIQVPGSAMYSLA
LYYMLKTPLEEHPLLESFVNGDDAYRNSRFKLIPHISKGSWIVKQSVGKKACLVGQVLEV
CYTRGKNYLELDIDVGSSTVARGVTNLVLGYLNNLVIEMAFLIQANTVEELPELLLGTCR
LNYLDVSKSVKER
Download sequence
Identical sequences B9DGX7
NP_001030862.1.80155 NP_191040.2.80155 AT3G54800.1 AT3G54800.2 3702.AT3G54800.1-P AT3G54800.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]