SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001032109.2.80155 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001032109.2.80155
Domain Number 1 Region: 2-63
Classification Level Classification E-value
Superfamily SAP domain 1.01e-17
Family SAP domain 0.0047
Further Details:      
 
Domain Number 2 Region: 105-169
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000159
Family PHD domain 0.0000202
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001032109.2.80155
Sequence length 884
Comment DNA-binding protein with MIZ/SP-RING zinc finger, PHD-finger and SAP domain-containing protein [Arabidopsis thaliana]; AA=GCF_000001735.3; RF=reference genome; TAX=3702; STAX=3702; NAME=Arabidopsis thaliana; ecotype=Columbia; AL=Chromosome; RT=Major
Sequence
MDLEANCKEKLSYFRIKELKDVLTQLGLSKQGKKQELVDRILTLLSDEQAARLLSKKNTV
AKEAVAKLVDDTYRKMQVSGASDLASKGQVSSDTSNLKVKGEPEDPFQPEIKVRCVCGNS
LETDSMIQCEDPRCHVWQHVGCVILPDKPMDGNPPLPESFYCEICRLTRADPFWVTVAHP
LSPVRLTATTIPNDGASTMQSVERTFQITRADKDLLAKPEYDVQAWCMLLNDKVLFRMQW
PQYADLQVNGVPVRAINRPGGQLLGVNGRDDGPIITSCIRDGVNRISLSGGDVRIFCFGV
RLVKRRTLQQVLNLIPEEGKGETFEDALARVRRCIGGGGGDDNADSDSDIEVVADFFGVN
LRCPMSGSRIKVAGRFLPCVHMGCFDLDVFVELNQRSRKWQCPICLKNYSVEHVIVDPYF
NRITSKMKHCDEEVTEIEVKPDGSWRVKFKRESERRELGELSQWHAPDGSLCPSAVDIKR
KMEMLPVKQEGYSDGPAPLKLGIRKNRNGIWEVSKPNTNGLSSSNRQEKVGYQEKNIIPM
SSSATGSGRDGDDASVNQDAIGTFDFVANGMELDSISMNVDSGYNFPDRNQSGEGGNNEV
IVLSDSDDENDLVITPGPAYSGCQTDGGLTFPLNPPGIINSYNEDPHSIAGGSSGLGLFN
DDDEFDTPLWSFPSETPEAPGFQLFRSDADVSGGLVGLHHHSPLNCSPEINGGYTMAPET
SMASVPVVPGSTGRSEANDGLVDNPLAFGRDDPSLQIFLPTKPDASAQSGFKNQADMSNG
LRSEDWISLRLGDSASGNHGDPATTNGINSSHQMSTREGSMDTTTETASLLLGMNDSRQD
KAKKQRSDNPFSFPRQKRSNNEQDHQTRHRSLNKICIILCAGKN
Download sequence
Identical sequences Q680Q4
NP_001032109.2.80155 AT5G60410.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]