SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001034289.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001034289.1.92730
Domain Number 1 Region: 29-219
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.0000000000144
Family Quinoprotein alcohol dehydrogenase-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001034289.1.92730
Sequence length 994
Comment ER membrane protein complex subunit 1 isoform 2 precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MAVAVASGFWIWAAVLLVPAAAVYEDQVGKFDWRQQYVGKIKFASLEFSPGSKKLVVATE
KNVIAALNSRTGEILWRHVDKGTAEGAVDAMLVHGQDAITVSNGGRLMRSWETNIGGLNW
EITLDTGSFQALGLVGLQESVRYIAVLKKTTLTLHHLSSGHLKWVEHLPESDSILYQMVY
SYGSGVVWALGIVPFSHVNIVKFNVEDGEIVQQVRVWTPWLQHLTGACGVVDEAVLVCPD
PSSHSLHTLALETEWELRQIPLQSPDLEFGSGFQPQVLPTQPSPVAPSRAQFFLQLSPSH
YALLHYHHGAVTLLKNFPQATLVSFATTGEKTVAAVMTCRTEVQKPVSAGDGSVASFPET
SGAQDSLACFNQTYTINLYLVETGRRLLDTSISFSLEQKGTRPEQLYIQVFLKKDDSVGY
RALVQTQDHLQLFLQQLAGKVVLWSREESLAEVVCLEMVDLPLTGAQAELEGEFGKKADG
LLGMFLKRLSSQLILLQAWTSHLWKMFYDARKPRSQIKNEINIDTLARDEFNLQKMMVTV
TASGKLFGIESSSGTILWKQYLPNVKPDSSFKLMVQRTTAHFPHPPQCTLLVKDKETGMS
SLFVFNPIFGKWSQVAPPVLKRPILQSLLLPVMDQDYAKVLLLVDDEYKVTAFPATRNVL
RQLHELAPSIFFYLVDAEQGRLSGYQLRKDLTTELSWELTIPPEVQRVVKVKGKRSSEHV
HSQGRVMGDRSVLYKSLNPNLLAVVTESTDVHHERTFIGIFLIDGVTGRIIHSSVQKKAR
GPVHLVHSENWVVYQYWNSKARRNELTALELYEGTEQYNATAFSSLDRPQLPQVLQQSYI
FPSSISAMEATITERGITSRHLLIGLPSGAILSLPKALLDPRRPEIPTEQSREENLIPYS
PDVQVHAERFINYNQTVSRMRGIYTAPSGLESTCLVVAYGLDIYQTRVYPSKQFDVLKDD
YDYVLISSVLFGLVFATMITKRLAQVKLLNRAWR
Download sequence
Identical sequences NP_001034289.1.92730 ENSMUSP00000049034

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]