SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001036053.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001036053.1.87134
Domain Number 1 Region: 91-277
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 5.18e-24
Family Adenylation domain of NAD+-dependent DNA ligase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001036053.1.87134
Sequence length 360
Comment snurportin-1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MEELSQALASSFSVSQDLNSTAAPHPRLSQYKSKYSSLEQSERRRRLLELQKSKRLDYVN
HARRLAEDDWTGMESEEENKKDDEEMDIDTVKKLPKHYANQLMLSEWLIDVPSDLGQEWI
VVVCPVGKRALIVASRGSTSAYTKSGYCVNRFSSLLPGGNRRNSTAKDYTILDCIYNEVN
QTYYVLDVMCWRGHPFYDCQTDFRFYWMHSKLPEEEGLGEKTKLNPFKFVGLKNFPCTPE
SLCDVLSMDFPFEVDGLLFYHKQTHYSPGSTPLVGWLRPYMVSDVLGVAVPAGPLTTKPD
YAGHQLQQIMEHKKSQKEGMKEKLTHKASENGHYELEHLSTPKLKGSSHSPDHPGCLMEN
Download sequence
Identical sequences O95149
ENSP00000309831 ENSP00000454852 ENSP00000456224 ENSP00000458053 ENSP00000309831 ENSP00000454852 ENSP00000456224 ENSP00000458053 NP_001036046.1.87134 NP_001036046.1.92137 NP_001036053.1.87134 NP_001036053.1.92137 NP_005692.1.87134 NP_005692.1.92137 gi|110611149|ref|NP_001036046.1| gi|110611151|ref|NP_001036053.1| gi|5031833|ref|NP_005692.1| GO.36572 9606.ENSP00000309831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]