SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001039656.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001039656.1.59421
Domain Number 1 Region: 177-329
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000541
Family Growth factor receptor domain 0.0078
Further Details:      
 
Weak hits

Sequence:  NP_001039656.1.59421
Domain Number - Region: 143-176
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00787
Family EGF-type module 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001039656.1.59421
Sequence length 351
Comment cysteine-rich with EGF-like domain protein 2 precursor [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MRPPAPAVLGLLLLLLPTGEATKKPTPCKRCRELVDKFNQGMVDTAKKNFGGGNTAWEEK
TLSKYEFSEVRLLEIVEGLCEASDFECNQLLEEQEELLEAWWLRLKKKHPDLFEWFCVQT
LKACCSPGTYGPDCLACQGGSERPCSGNGHCVGDGTREGDGSCQCHLGYQGPLCSDCMDG
YFRSPTSETHSICSACDEACKTCVGPTNRDCGQCEVGWVRQDDACVDVDECAAEPPPCED
TQYCENVNGSFVCEECDPTCMGCTGKGPTQCRECIAGYSKESGQCEDIDECSLAEKPCLR
DNENCYNTPGSFVCVCPDGFEEAEDTCVQTRPAGAEATEASPTQPPSREDL
Download sequence
Identical sequences Q2KIT5
ENSBTAP00000054551 ENSBTAP00000054551 NP_001039656.1.59421 NP_001039656.1.76553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]