SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001039821.1.59421 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001039821.1.59421
Domain Number 1 Region: 250-316
Classification Level Classification E-value
Superfamily FnI-like domain 1.12e-16
Family VWC domain 0.004
Further Details:      
 
Domain Number 2 Region: 32-97
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000488
Family VWC domain 0.017
Further Details:      
 
Domain Number 3 Region: 109-176
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000000436
Family VWC domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001039821.1.59421
Sequence length 430
Comment chordin-like protein 2 precursor [Bos taurus]; AA=GCF_000003205.7; RF=na; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Major
Sequence
MVPEVRVLSSLLGLALLWFPLDSHARARPDMFCLFHGKRYSPGESWHPYLEPQGLMYCLR
CTCSENAHVSCYRLHCPPVHCPQPVTEPQQCCPRCVEPHTPSGLRAPPRSCQHNGTTYQH
GEIFSAHELLPSHLPNQCVLCSCTEGQIYCGLMTCPEPGCPAPLPLPASCCQACKDGSSE
KSAEEDTTQSHQGVKHSQDLCSGDSGRKRDLSTPSPTGPSASLGFIPRHFRPKEAGSTTV
KIVLKEKHKKACVHGGKTYSHGEVWHPAFRSFGPLPCILCTCQDGRQDCQRVICPTAYPC
HHPEKVAGKCCKICPEDKADSGHSEISATKCPKAPGRVLVHTSVSPSPDNLRRFALEREA
SEQVEIYLWKLVKGIFHLIQIKKVRKQDFQKEAQNFRLLTGTHEGHWNIFLAQTPELKVT
ASPDKMTKTL
Download sequence
Identical sequences Q2KJ20
ENSBTAP00000032603 ENSBTAP00000032603 NP_001039821.1.59421 NP_001039821.1.76553 XP_005903283.1.15283 XP_010847169.1.44457 XP_019831192.1.53367 9913.ENSBTAP00000032603

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]