SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001071133.2.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001071133.2.87134
Domain Number 1 Region: 467-579
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.7e-37
Family Pyk2-associated protein beta ARF-GAP domain 0.00051
Further Details:      
 
Domain Number 2 Region: 283-344,407-452
Classification Level Classification E-value
Superfamily PH domain-like 6.95e-20
Family Pleckstrin-homology domain (PH domain) 0.0096
Further Details:      
 
Domain Number 3 Region: 591-681
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.31e-16
Family Ankyrin repeat 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001071133.2.87134
Sequence length 686
Comment arf-GAP with GTPase, ANK repeat and PH domain-containing protein 6 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MGNILTCRVHPSVSLEFDQQQGSVCPSESETYEAGARDRMAGAPMAAAVQPAEVTVEVGE
DLHMHHVRDREMPEALEFNLSANPESSTIFQRNSQTEALEFNPSANPEASTIFQRNSQTD
VVEIRRSNCTNHVSAVRFSQQYSLCSTIFLDDSTAIQHYLTMTIISVTLEIPHHITQRDA
DRTLSIPDEQLHSFAVSTVHIMKKRNGGGSLNNYSSSIPSTPSTSQEDPQFSVPPTANTP
TPVCKRSMRWSNLFTSEKGSDPDKERKAPENHADTIGSGRAIPIKQGMLLKRSGKWLKTW
KKKYVTLCSNGMLTYYSSLGDYMKNIHKKEIDLQTSTIKVPGKWPSLATSACTPISSSKS
NGLSKDMDTGLGDSICFSPSISSTTSPKLNPPPSPHANKKKHLKKKSTNNFMIVSATGQT
WHFEATTYEERDAWVQAIQSQILASLQSCESSKSKSQLTSQSEAMALQSIQNMRGNAHCV
DCETQNPKWASLNLGVLMCIECSGIHRSLGPHLSRVRSLELDDWPVELRKVMSSIVNDLA
NSIWEGSSQGQTKPSEKSTREEKERWIRSKYEEKLFLAPLPCTELSLGQQLLRATADEDL
QTAILLLAHGSCEEVNETCGEGDGCTALHLACRKGNVVLAQLLIWYGVDVMARDAHGNTA
LTYARQASSQECINVLLQYGCPDECV
Download sequence
Identical sequences ENSP00000400972 ENSP00000400972 gi|166851846|ref|NP_001071133.2| NP_001071133.2.87134 NP_001071133.2.92137 ENSP00000400972 ENSP00000475217 9606.ENSP00000363168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]