SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001071465.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001071465.1.76553
Domain Number 1 Region: 157-226
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000000136
Family VWC domain 0.019
Further Details:      
 
Domain Number 2 Region: 284-359
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000103
Family VWC domain 0.021
Further Details:      
 
Domain Number 3 Region: 626-683
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000376
Family BSTI 0.055
Further Details:      
 
Domain Number 4 Region: 99-165
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000199
Family VWC domain 0.0047
Further Details:      
 
Domain Number 5 Region: 62-106
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000722
Family VWC domain 0.04
Further Details:      
 
Domain Number 6 Region: 236-289
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000722
Family VWC domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001071465.1.76553
Sequence length 685
Comment BMP-binding endothelial regulator protein precursor [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MLWFSGVRALAERPCRRSPGITCCVLLLLNCSGVPMSLASSFLTGSVAKCENEGEVLQIP
FITDNPCIMCVCMNKEVTCKREKCPVLSRDCALAIKQRGACCERCKGCTYDGSTYNSSFK
WQNPAEPCVLRQCQEGVVTESEVRCVVHCKNPSKHLGTCCPTCPGCVFEGVQYQEGEEFQ
PEGDKCTKCSCVGGRTQCVREVCPILSCPQHLSHIPPGQCCPKCLGQRKVFDLPFGSCLF
RSDVYDNGSSFLYDNCTACTCKDSTVVCKKKCSHPGGCDRGEEACCDDCLLRVPQEDIKV
CKFGNKIFRDGEMWSSVNCTICACVKGKTECRKKQCVPISSCPQGKILNRKGCCPICTEK
PGVCTVFGDPHYNTFDGRTFNFQGTCQYVLTKDCSSPASPFQVLVKNDARRTRSFSWTKS
VDLVLGAGTVSLQQHLTVRWNGSRIALPCHAPQFHIDLDGYLLKVTTKAGLEISWDGDSF
VEVMAAPHLKGKLCGLCGNYNGHKRDDLIGGDGSFKFDVDDFAESWRVESNEFCNRPQRK
PVPELCQGTVKVKLRAHRECQKLKSWEFQTCHSTVDYTTFYRSCVTDMCECPVHKNCYCE
SFLAYTRACQREGIRVHWEPQQNCAATQCKHGAVYDTCGPGCAKTCDNWNEIGPCNKPCV
AGCHCPANLVLHKGRCIKPVLCPQR
Download sequence
Identical sequences A0JNC8
ENSBTAP00000043607 ENSBTAP00000043607 NP_001071465.1.59421 NP_001071465.1.76553 XP_019814342.1.53367

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]