SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001073077.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001073077.1.76553
Domain Number 1 Region: 46-299
Classification Level Classification E-value
Superfamily Carbonic anhydrase 2.36e-76
Family Carbonic anhydrase 0.00000602
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001073077.1.76553
Sequence length 328
Comment carbonic anhydrase-related protein 10 precursor [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLC
SVGKRQSPVNIETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGG
PMTYSHRLEEIRLHFGSEDSQGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLV
VVSIFIKVSDSSNPFLNRMLNRDTITRITYKNDAYLLQGLNIEELYPETSSFITYDGSMT
IPPCYETANWIIMNKPVYITRMQMHSLRLLSQNQPSQIFLSMSDNFRPVQSLNNRCIRTN
INFSLQGKDCPNNRAQKLQYRVNEWLLK
Download sequence
Identical sequences A0JN41
NP_001073077.1.59421 NP_001073077.1.76553 XP_004012427.1.66739 XP_005971282.1.78601 XP_005971283.1.78601 XP_013827228.2.57651 ENSBTAP00000046047 ENSBTAP00000046047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]