SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001073599.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001073599.1.92730
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily LEM domain 6.93e-23
Family LEM domain 0.000057
Further Details:      
 
Domain Number 2 Region: 107-154
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000000327
Family LEM domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001073599.1.92730
Sequence length 412
Comment lamina-associated polypeptide 2 isoform delta [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGANSK
GPPDFSSDEEREPTPVLGSGASVGRGRGAVGRKATKKTDKPRLEDKDDLDVTELSNEELL
DQLVRYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTVSSSAENTRQNGSNDSD
RYSDNDEDSKIELKLEKREPLKGRAKTPVTLKQRRTEHNQVETSQHFRIDGAVISESTPI
AETIKASSNESLVANRLTGNFKHASSILPITEFSDITRRTPKKPLTRAEVGEKTEERRVD
RDILKEMFPYEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYAPLADVK
SEKTKKRRSVPMWIKMLLFALVAVFLFLVYQAMETNQGNPFTNFLQDTKISN
Download sequence
Identical sequences Q3TNH0
ENSMUSP00000089864 NP_001073599.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]