SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001088997.1.7800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001088997.1.7800
Domain Number 1 Region: 519-554,638-712
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000267
Family Anti-sigma factor antagonist SpoIIaa 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001088997.1.7800
Sequence length 769
Comment pendrin-like anion exchanger [Xenopus laevis]; AA=GCF_001663975.1; RF=representative genome; TAX=8355; STAX=8355; NAME=Xenopus laevis; strain=J; AL=Chromosome; RT=Major
Sequence
MESSTDSKYFVARSVYSDQSFKEEHEKREIVHRPLKQKLKKTFSCTPKKAYRVAKTFIPV
LDWLPKYRWKEWIVSDIIAGVSVGLISALQGLAFGLLAGVPIQFGLYSSFFPVLTYCFLG
TSKHISVGPFPVVCLMVGIVTISMAPDDQFSVITNGTTVINTTARDAARINICGTLSFLI
GILQLFLGIFRIGFIVRYLADPLIGGFTTAAAFQVTVSQIKTILNVPAKNYNGVLSIIYT
IIDIFSNIAQTNFADLIAGLLTLVIVLAVKEVNDRFKEKIRVPIPIEIIVTIVATGISYG
ANLAGKYNAGIIKTIPSGFIPAMSPDVSLFSSLISSAFSTGIVAYAIVISVGKVYGTKNN
YRVDGNQEFIAYGISNMFGGIFSCFCASTALSRTAIQEGTGGKSQIASMISALMVLIAIV
AIGRLLEPLQKSVLAAIVVANLKGMFMQVRDIPVLWRQNRWDAVIWVFTCVSAIILGLDL
GLLAGLVFGLLTVVLRVQFPSCSSLANIHNTDLYKDVKMYKDLIEPGGVRIIRFSGGIFY
GNIEGLKNGIKKIVGFDATRVFDKRAKALRMIQNLIKKGQLGATWNGIVSGTGIDNEGFE
LDDEQDDPELEQNHDIHTNEVEIQVDWNSELPLTVSVPKVTVHTIVFDFAPVTFLDVMAV
KNLKLIIKEFKRIDVDIYIAACDDNVYNKMEVCGFFDDAIKPDIFFLTVHDAMLYIEKER
NFESASDPILEKISLMQENKGQLDFLIEPVDPVHQELAAHEEAIKRYAS
Download sequence
Identical sequences Q5ZQQ9
gi|147903861|ref|NP_001088997| gi|33333158|gb|AAQ11740| NP_001088997.1.7800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]