SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001095554.1.76553 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001095554.1.76553
Domain Number 1 Region: 30-228
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 9.11e-42
Family Laminin G-like module 0.003
Further Details:      
 
Domain Number 2 Region: 478-589
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000133
Family Growth factor receptor domain 0.0075
Further Details:      
 
Domain Number 3 Region: 268-332
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000068
Family VWC domain 0.011
Further Details:      
 
Domain Number 4 Region: 432-474
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000794
Family EGF-type module 0.016
Further Details:      
 
Domain Number 5 Region: 688-760
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000303
Family VWC domain 0.011
Further Details:      
 
Domain Number 6 Region: 595-636
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000288
Family EGF-type module 0.019
Further Details:      
 
Weak hits

Sequence:  NP_001095554.1.76553
Domain Number - Region: 333-398
Classification Level Classification E-value
Superfamily FnI-like domain 0.000879
Family VWC domain 0.076
Further Details:      
 
Domain Number - Region: 398-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00261
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001095554.1.76553
Sequence length 816
Comment protein kinase C-binding protein NELL2 precursor [Bos taurus]; AA=GCF_000003055.6; RF=representative genome; TAX=9913; STAX=9913; NAME=Bos taurus; breed=Hereford; AL=Chromosome; RT=Minor
Sequence
MESRVLLRTFCLLFGLGAVWGLGVDPSLQIDVLTELELGESTTGVRQVPGLHNGTKAFLF
QDTPRSIKASTATAEQFFQKLRNKHEFTILVTLKQTHLNSGVILSIHHLDHRYLELESSG
HRNEVRLHYRSGSHHPHTEVFPYILADDKWHKLSLAISASHLILHIDCNKIYERVVEKPS
TDLPLGTSFWLGQRNNAHGYFKGIMQDVQLLVMPQGFIAQCPDLNRTCPTCNDFHGLVQK
IMELQDILAKTSAKLSRAEQRMNRLDQCYCERTCTMKGTTYREFESWTDGCKNCTCLNGT
IQCETLICPNPDCPLKSAPAYVDGKCCKECKSICQFQGRTYFEGQRNTVYSSSGVCVLYE
CKDQSMKLVESSGCPALDCAESHQITLSHSCCKVCKGYDFCSERHNCMENSVCRNLNDRA
VCSCRDGFRALREDNAYCEDIDECAEGRHYCRENTMCVNTPGSFMCICKTGYIRIDDYSC
TEHDECVTNQHNCDENALCFNTVGGHNCVCKPGYTGNGTTCKAFCQDGCRNGGACIAANV
CACPQGFTGHSCETDIDECSDGFVQCDSRANCINLPGWYHCECRDGYHDNGMFSPSGESC
EDIDECGTGRHSCANDTICFNLDGGYDCRCPHGKNCTGDCIHDGKIKHNGQIWVLENDRC
SVCSCQNGFVMCRRMVCDCENPTVDLFCCPECDPRLSSQCLHQNGETLYNSGDTWVQNCQ
QCRCLQGEVDCWPLPCPEVECEFSVLPENECCPRCVTDPCQADTIRNDITKTCLDEMNVV
RFTGSSWIKHGTECTLCQCKNGHICCSVDPQCLQEL
Download sequence
Identical sequences A6QR11
ENSBTAP00000042993 NP_001095554.1.59421 NP_001095554.1.76553 XP_005206438.1.76553 XP_005206439.1.76553 ENSBTAP00000042993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]