SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001096210.1.99540 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001096210.1.99540
Domain Number 1 Region: 521-551,661-739
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000502
Family Anti-sigma factor antagonist SpoIIaa 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001096210.1.99540
Sequence length 794
Comment solute carrier family 26 member 9 [Xenopus tropicalis]; AA=GCF_000004195.3; RF=representative genome; TAX=8364; STAX=8364; NAME=Xenopus tropicalis; strain=Nigerian; AL=Chromosome; RT=Major
Sequence
MNKVRPRYIIDRPAYSVELFNEEYEKKIRSYPIGGKARKLFSCSTSKIKNFIFRLFPILS
WLPKYNIKGNLLNDALGGISAGTIQIPQGMAFALLANLPPVNGLYSSFFPLVVYFFMGGI
PQMVPGTFAVISIIVGNVCLKLAPESHFQNVTSNGTITNIEAMNTARMHISATLACLTAI
IQIALSFVQFGFVAIYLSESFIRGFMTAAGLQILISVLKYIFGVSIPPYSGVLAIIYTFI
DICKELPKTNVASLIFALISTVLLIIVKELNMKFMHKIRFPIPMEIIIVIVATAVSGSFK
LPERYHMNVVGHIPLGFPSPTVPNVTQWDEMVGTAFSLAIVGYVINLAMGRTLGAKHGFD
VDANQEMLALGSGNFFGSFFFIHVICCALSVTLAVDGAGGKSQIASFFVMMSVMVTILAL
GTYLNPLPKSVLGALIAVNLKNSLKQLSDPFYLWKKSKLDCLVWLVSFFSTFILGLPYGL
AVGVAFSILVVIFNTQFRNGSSLNQVTATDIYVNPKVYSKVQPIDGIKIVTYCSPLYFAN
SEIFRQKVIKKTGLDPGKVYLSKKKYLKQQEQELKKKEQKKKRGSLFMKNKTLSLQELQE
DFDGVSPTDSNNNSTVNGTASAISYISSNTLTSGSQTTENVQNGFSTPAQTQDPIIAAPP
IVNFHTVIIDMSGVCFVDLMGIKALGKLCTSFQRIGVNVYLADVQAQVYDDIENGGMFAE
GSLDRKHLFITVHDAVLYAEANNTGIVNTDSKKKGAGDTEIYITDTQDEISEDYPNLEEA
MFGSMFQTEIQTAL
Download sequence
Identical sequences A4IIF2
NP_001096210.1.99540 gi|134024488|gb|AAI35994| gi|156717340|ref|NP_001096210| gi|172044158|gb|A4IIF2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]