SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001098104.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001098104.1.92730
Domain Number 1 Region: 31-509
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.67e-91
Family L-arabinose binding protein-like 0.00073
Further Details:      
 
Weak hits

Sequence:  NP_001098104.1.92730
Domain Number - Region: 520-580
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00989
Family Growth factor receptor domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001098104.1.92730
Sequence length 853
Comment vomeronasal receptor Vmn2r20 precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MKLLIAFSLWIVLIVLQEQISCYLLSISASPGYYQDGDFVIGGLLSLKVSGRHNKNKFTS
GNEYNLPEYVYIDFTKHYQHILAMVFAIEKINKDPNILFNMSLGFHVFNVDFTEMKAMKS
SMVLLSGESPPVPNYSCRPEKTDKLVAVIGGISTGISTQISRVLSLYNVPQISYAPFDQS
LGTIVQLQSPYQFPVHTAALYQGIIQLLLYFTWVWVGLVVPDDIRGELFLRDITEEMMNH
GLCVAFAEKIQGILAEDKVNTKLFNEKFTLTRVIIAFGDTYSLLALAVHTTFYTTFRNVW
ITTSDWDITFYFQQPKSYEYFGGGLSFTDRMDQILGFKDFLRNVQPRKYPQDIFIQDVWM
VLFECPYLIDHEARQLSQCEPNGSLSTRPLHVWDMNTSPCSSKVHAAVYAIAQALHEELS
LRVEGGSLDKSVLRAPLPWKLHPFLQKGQLGRSSNKENIVNKEILATEFDIFNYQSLQSG
TKAQVKVGEFVFESHSVQHFSLNEKLITWGKYGKEIPLSVCSQSCPLGFRKTPVEGKSFC
CFDCLPCPEGEIANETDMDQCIKCPEDQYPNKQKNNCLPKIKIFLSHEDTLGAVLVSLAI
SLSAFSAMILGLFIHYRDTPIVRANNRNLSYVLLVSLMLCFFCSLIFIGQPSTVTCVLRQ
MIFGVVFSVAVSAILAKTFIVVVAFTAIKPGSTLQMWMVTRLSNAIVCCGSIIQVCICAV
WLGTSPPFPDVDMHSEFGQIILWCNEGSTLAFYCVLGYLGFLSSLSLLIAFLARRLPESF
NEAKTITFSMLVFCTVWITFVPTYLSSKGKTMVAVEILSILASSSILLLCIFLPKCYVIL
LRSGGHSRKKFFK
Download sequence
Identical sequences L7N2B1
ENSMUSP00000129145 ENSMUSP00000129145 NP_001098104.1.92730 ENSMUSP00000129145 PGOMOU00000137309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]