SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001098540.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001098540.1.92730
Domain Number 1 Region: 51-490
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.06e-100
Family L-arabinose binding protein-like 0.0025
Further Details:      
 
Weak hits

Sequence:  NP_001098540.1.92730
Domain Number - Region: 512-559
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0129
Family TNF receptor-like 0.0081
Further Details:      
 
Domain Number - Region: 607-814
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.0183
Family Calcium ATPase, transmembrane domain M 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001098540.1.92730
Sequence length 861
Comment vomeronasal 2, receptor 38 precursor [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MFTLMGVFFFFNIPLFMANFIDPRCFWRINLNEIQDEYLGLTCAFILAAVQKPIEKDYFN
KTLNFLKTTKNHKYALALAFAMDEINRNPDLLPNMSLIIRYTLGRCDGKTVIPTPYLFHK
KKQSPIPNYFCNEETMCSFLLTGPNWGVSISFWKYLDSFLSPRILQLTYGPFSSIFSDDE
QYSYLYQMAPKDTSLALAMVSFILYFNWNWIGLVIPDDDQGNQFLLELKKQRENKEICFA
FVKMISVDDISFEHKTEMYYKQIVMSSSNVIIIYEETIDFIDLIFRMWEPPVLQRIWITT
KQWNFPTSKRDITHGTFYGSLTFLPHHGGISGFKDFVQTWFHLRSKDLYLVMPEWKYFKY
ESSASKCKILKNNSSDASFDWLMEQKFDMAFSESSHNIYNAVHAIAHALHEMNLQQVDNQ
AIDNGKGASSHCLKVNSFLRKIHFTNPLGNKVIMKQRVIMQEEYDIFHFGNLSQHLGIKV
KLGKFSPYFSHGRNFHLYVDMLEVATGSRKMPSSVCSAECSPGFRRLWKEGMAACCFVCS
PCPENEISNETNMDQCVNCPEYQYANTEQNKCIQKGVTFLSYEDPLGMALALMAFCFSAF
TAVVLCVFVKYHDTPIVKANNRILSYILLISLMSCFLCSFFFIGHPNRATCVLQQITFGI
VFTVAVSTVLAKTVTVVLAFKVTDPGRRLRNFLVSGTPNYIIPICSLLQCVLCAIWLEVS
PPFVDIDEHSQHGHIIIVCNKGSVTAFYCVLGFLACLALGSFSLAFLAKNLPDTFNEAKF
LTFSMLVFFSVWVTFLPVYHSTKGKVMVAVEIFSILASSAGMLGCIFAPKIYIILMRPDR
NSTQKIKVRNSTQKIKEKSYF
Download sequence
Identical sequences G3UYA8
NP_001098540.1.92730 ENSMUSP00000104194 ENSMUSP00000104194 ENSMUSP00000104194

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]