SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001099342.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001099342.1.4139
Domain Number 1 Region: 23-355
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.66e-113
Family Transferrin 0.000000291
Further Details:      
 
Domain Number 2 Region: 365-704
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.13e-112
Family Transferrin 0.000000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001099342.1.4139
Sequence length 738
Comment melanotransferrin precursor [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MRLLSVTFWLLLSLRTVLCVMEMQWCTISDPEQQKCKDMSKAFQGAGIQPSLLCVQGTST
DHCVQLIKDQKADAITLDGGAIYQAGKEYGLKPVVGEVYDQDIGTSYYAVAVVRRNSNVT
INTLKGVKSCHTGINRTVGWNVPVGYLVETGHLSVMGCDVLKAVGDYFGGSCVPGAGETS
HSESLCRLCRGDSSGHNVCDKSPLERYYDYSGAFRCLAEGAGDVAFVKHSTVLENTDGKT
LPSWGKALMSQDFQLLCRDGSRADITEWRRCHLAKVPAHAVVVRDDMDGGLIFRLLNEGQ
LLFSHEDSSFQMFSSKAYGQKNLLFKDSTLELVPIATQNYESWLGQEYLHAMKGLLCDPN
RLPHYLRWCVLSVPEIQKCGDMAVAFSRQSLKPEIQCVSAESPEHCMQQIQAGHIDAVTL
RGEDIYRAGKAYGLVPAAGELYAEEDRSNSYFVVAVVRRDSSYSFTLDELRSKRSCHPGL
GSPAGWEVPIGSLIQRGFIRPKDCDVLTAVSEFFNASCVPVNNPKNYPSSLCALCVGDEK
GRNKCVGSSQERYYGYSGAFRCLVENAGDVAFLKHTTVFENTNGHNPEPWASHLRWQDYE
LLCPNGARAEVDQFQACNLAQMPSHAVMVHPDTNIFTVYGLLDKAQDLFGDDHNKNGFQM
FDSSKYHSQDLLFKDATVRAVPVREKTTYLDWLGPDYVVALEGMLSQQCSGAGAAVHRVP
PPALLLLALAAGLLPRVL
Download sequence
Identical sequences D4ADK7
NP_001099342.1.100692 NP_001099342.1.4139 ENSRNOP00000002373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]