SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001099398.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  NP_001099398.1.100692
Domain Number - Region: 106-157
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.000209
Family VPS37 C-terminal domain-like 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001099398.1.100692
Sequence length 285
Comment vacuolar protein sorting-associated protein 37B [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MAGAVSEARFAGLSLMQLHELLEDDAQLGDMVRGMEETQTVQHNKEMTLASNRSLAEGNL
LYQPQLDAQKARLTQKYQELQVLFEAYQIKKTKLDKQSNSASLETLLALLQAEGAKIEED
TENMAEKFLDGELPLDAFIDVYQSKRKLAHIRRVKVEKLQELVLKGQRLPQAGVPLPPRV
PEPSPATALPYPPLEATGLPSVVPRRIPPPPPPVPAGHVATPFTAAMGSGQASAYPGLQC
PPLPPRVGLPSQQGFSTQLVSPYPPALPQRPPPRMAPHQPGFILQ
Download sequence
Identical sequences D3ZU64
ENSRNOP00000001445 NP_001099398.1.100692 NP_001099398.1.4139 10116.ENSRNOP00000001445 ENSRNOP00000001445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]