SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001099694.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001099694.1.100692
Domain Number 1 Region: 4-155
Classification Level Classification E-value
Superfamily UBC-like 4.35e-50
Family UBC-related 0.000000113
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001099694.1.100692
Sequence length 223
Comment ubiquitin-conjugating enzyme E2 S [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MNSNVENLPPHIIRLVYKEVTTLTADPPDGIKVFPNEEDLTDLQVTIEGPEGTPYAGGLF
RMKLLLGKDFPASPPKGYFLTKIFHPNVGPNGEICVNVLKRDWTAELGIRHVLLTIKCLL
IHPNPESALNEEAGRLLLENYEEYAARARLLTEIHGGACSTSSGRAEASRDLASGASASS
TDPMTPGVLGGAEGPMAKKHAGERDKKLAAKKKLDKKRALRRL
Download sequence
Identical sequences B5DFI8
10116.ENSRNOP00000022977 ENSRNOP00000022977 NP_001099694.1.100692 NP_001099694.1.4139 ENSRNOP00000022977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]