SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001099987.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001099987.1.4139
Domain Number 1 Region: 156-525
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.61e-95
Family GABA-aminotransferase-like 0.0000138
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001099987.1.4139
Sequence length 563
Comment serine palmitoyltransferase 3 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MANPRDSAVTNGTLRNPKTQPGKRQSTDCVKNGISKEAQQNRKAEEDDKLVFKPYPEPPL
YVFVFTYMGYGIGMLFGYLRDFMRNWGIEKCNAAVEREEQKDFVPLYQDFENFYTRNLYM
RIRDSWSHTVCSVPVPNFDIMEKVTDDYNWTFRHTGKVIKNVINMASYNYLGLASKYNES
MEKVKDTIEKYGVGVASTRNEMGSLDIHNELEDLMAKFLNVEAVMVFGMGFATNSTNIPI
FVGKGCLILSDEFNHTSVILGSRLSGAVIRPFKHNNIQNLEKLLREAIIRGQPRTGRAWK
KILILVEGVYSMEGSIVNLPQIVALKKKYKAYLYMDEAHSIGCTGTMGQGIRELFGLAPE
DIDIYMGTFTKSFAASGGYIAGKKEIVDYVRVQSHSATYATSMSPVVAAQIIRSLKIMMG
YEGNFGGVQRIQQLRENIKYFRRRLIEMGFIIYGNDYSPVVPVLLYMPAKVSAFGRLLLK
KKIAVVVVGFPATSLPEGRARFSLSSAHTREMLDTVLEVVDKIGDLLNVKYFPYKKSGRA
VLYNKENFDNEASFEEKSSEPEA
Download sequence
Identical sequences D4A9V0
NP_001099987.1.100692 NP_001099987.1.4139 ENSRNOP00000005920 10116.ENSRNOP00000005920 ENSRNOP00000005920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]