SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001100933.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001100933.1.100692
Domain Number 1 Region: 97-151
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.00000687
Family VPS37 C-terminal domain-like 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001100933.1.100692
Sequence length 353
Comment vacuolar protein sorting-associated protein 37C [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MEGLKDKTLQELEEMQNDPEAIARLALESPEVQDLQLEREMALATNRSLAEQNLEFQGPL
EISRSNLSDKYQELRKLVERCQEQKAKLEKFSSALQPGTLLDLLQIEGMKIEEESEAMAE
KFLEGEVPLETFLESFSSMRTLLHLRRVRVEKLQDVVRRPRALPELAGDAPPKRPPPPRP
APQAAPPETEEQTPQPSVVTPYPLPYSPSPGLPVGPTAQGALQPAPFPVVTQPSSYGGPL
GPSYPSPQPGPRAMVGYSWSPQRSGPPRPGYPVAPTSTSGPGYPLVGGQTPGPGYPQQSP
YFPSGSKPPYPTQPQLPGFPGQPPPPVPPQPPYPSGVTPPYGFHPPGSAWPRY
Download sequence
Identical sequences B5DFF4
ENSRNOP00000001982 NP_001100933.1.100692 XP_003749107.1.100692 XP_006231095.1.100692 XP_006231096.1.100692 XP_006231097.1.100692 XP_006231140.1.100692 XP_006231141.1.100692 XP_017459892.1.4139 XP_017459893.1.4139 XP_017459894.1.4139 10116.ENSRNOP00000001982 ENSRNOP00000001982 ENSRNOP00000064140

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]