SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001123577.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001123577.1.87134
Domain Number 1 Region: 524-743
Classification Level Classification E-value
Superfamily Bet v1-like 3.85e-40
Family STAR domain 0.0055
Further Details:      
 
Domain Number 2 Region: 83-243
Classification Level Classification E-value
Superfamily PH domain-like 1.79e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001123577.1.87134
Sequence length 752
Comment collagen type IV alpha-3-binding protein isoform 3 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MQHSCIPTPPSPFSAPPAFLPVVTRESRRGLSSGGSAGRNAGVTATAAAADGWKGRLPSP
LVLLPRSARCQARRRRGGRTSSLLLLPPTPERALFASPSPDPSPRGLGASSGAAEGAGAG
LLLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNAL
SYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAI
EQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILC
RQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHSTNGNKEKLFPHVT
PKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKKRRTEEAYK
NAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTS
LPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQDV
GGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWE
TTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSVIRKIPALTENDPETWIVCNFS
VDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPAS
VLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences H2QR36
ENSPTRP00000029108 ENSP00000369862 gi|194294543|ref|NP_001123577.1| 9598.ENSPTRP00000029108 9606.ENSP00000369862 ENSPTRP00000029108 ENSP00000350046 NP_001123577.1.87134 NP_001123577.1.92137 XP_003810502.1.60992 XP_526893.2.37143 ENSP00000369862

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]