SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001123637.1.92730 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001123637.1.92730
Domain Number 1 Region: 91-135
Classification Level Classification E-value
Superfamily LysM domain 0.0000000102
Family LysM domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001123637.1.92730
Sequence length 832
Comment oxidation resistance protein 1 isoform D [Mus musculus]; AA=GCF_000001635.25; RF=reference genome; TAX=10090; STAX=10090; NAME=Mus musculus; AL=Chromosome; RT=Patch
Sequence
MDYLTTFTGKSGRLLRGTASRLWGLGGGGEARQVRFEDYLREPAPGDPGCGPEELRPPSP
ASPEGPDTGQKKTLDKKDGRRMSFQKPKGTIEYTVESRDSLNSIALKFDTTPNELVQLNK
LFSRAVVTGQVLYVPDPEYVSSVESSPSLSPVSPLSPTSSEAEFDKTTTPDVAHPKEAPP
ASTVSGIRPARVVSSTSEEEEAFTEKFLKINCKYITIGKGTVSGVLLVTPNNIMFDPHKT
DPLVQENGCEEYGIMCPMEEVMSAAMYKEILDSKIKESLPIELDQLSGRGSCHSKKATGV
SAEDADPRARDQGNDSASTAPRSTEESLSEDAFTESELSPIREELLSSEPRQEKSSDASS
ESVQTVSQMEVQSLTATSEAANVPDRTSSNPGALSHETGLSGLETATKGGDKATESLQEV
SGPKEQSTEVKGQDNQDSSHQESSLQQEAGEDSVSSGETVELKEKPAVLKDQQGQELKRD
SETEVEELRKLWKTHSMQQAKQQRDTIQQVSQRESKHSSAAADAHGEGSSLLKEKRRHRL
HKFLCLRVGKPMRKTFVSQASATMQQYAQRDKKHEYWFAVPQERTDHLYAFFIQWSPEIY
AEDSGEYTREPGFIVVKKMDESEANEAPAGEAAAREWEITTREDINSKQVAPAKADLEPE
SFRPNLSDPSELLLPDQIEKLTKHLPPRTIGYPWTLVYGTGKHGTSLKTLYRTMTGLDTP
VLMVIKDSDGQVFGALASEPFKVSDGFYGTGETFVFTFCPEFEVFKWTGDNMFFIKGDMD
SLAFGGGGGEFALWLDGDLYHGRSHSCKTFGNHTLSKKEDFFIQDIEIWAFE
Download sequence
Identical sequences E9Q0A7
ENSMUSP00000126266 NP_001123637.1.92730

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]