SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001128156.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001128156.1.45394
Domain Number 1 Region: 636-891
Classification Level Classification E-value
Superfamily YWTD domain 2.35e-55
Family YWTD domain 0.00000389
Further Details:      
 
Domain Number 2 Region: 21-282
Classification Level Classification E-value
Superfamily YWTD domain 1.19e-54
Family YWTD domain 0.00000186
Further Details:      
 
Domain Number 3 Region: 335-581
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-50
Family YWTD domain 0.00000317
Further Details:      
 
Domain Number 4 Region: 939-1200
Classification Level Classification E-value
Superfamily YWTD domain 2.09e-39
Family YWTD domain 0.0000386
Further Details:      
 
Domain Number 5 Region: 1329-1367
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000353
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 6 Region: 1251-1289
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000812
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 7 Region: 591-638
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000178
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 8 Region: 1291-1327
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000524
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 9 Region: 893-941
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000735
Family EGF-type module 0.012
Further Details:      
 
Domain Number 10 Region: 288-331
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000186
Family EGF-type module 0.0066
Further Details:      
 
Domain Number 11 Region: 1208-1261
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000347
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001128156.1.45394
Sequence length 1620
Comment low-density lipoprotein receptor-related protein 6 precursor [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MGAVLQTLLLCTLCLQIRGLPLLLYANRRDLRLVDAAHGRANATLVMGGLEDAAAVDYIY
AQGLIYWSDVSEESIKRTLFNGSAPSGVQTTVISGLASPDGLACDWMGNKLYWTDSETNR
IEVAELDGTHRKVLFWQDLDQPRAIALDPGRGFMYWTDWGEIPKIERAGMDGSLRSVIVE
TEIYWPNGLTLDYQQQQLYWADAKFNCIHRSNLDGSSREVVVKGSLPHPFALTLYEDTLF
WTDWNTHSIHSCHKHTGENSREVHSNIFSPMDIHVYSQQRQPMDVASPCSVRNGGCSHLC
LLSPAKPYYQCACPTGVQLLEDHKSCRDGGPSQLLLLARRTDLRRISLDTPDFTDIVLQA
EDIRHAIAIDYDPVEGHIYWTDDEVRAIRRSLLDGSDAQLVVTSQVNHPDGIAVDWIARN
LYWTDTGTDRIEVTRLNGTMRKILISEDLDEPRAIVLDPVAGYMYWTDWGEVPKIERAAL
DGSQRMVMVNTSLGWPNGLALDYSERKIYWGDAKTDVIEVMEMDGSGRRVLLEDNLPHVF
GFTLLGDYIYWTDWQRRSIERVHKRSTEREVIIDQLPDLMGIKATFVHQTFGVNPCAWAN
GGCSHLCLYRPQGVSCACPIGLELMADLSTCIVPEAFLLFSRHTDIRRISLETNNNNVAI
PLTGVKEASALDFDITDNRIYWTDITLKTISRAFMNGSSLEHVVEFGLDYPEGMAVDWLG
KNLYWADTGTNRIEVAKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGRPKIDRA
AMDGSGRITLVPNVGRANGLTIDYAERRLYWTDLDTTLIESSNMLGLEREVIADDLPHPF
GLTQYQDYIYWTDWSQRSIERANKTSGQNRTVIQGHLDYVMDILVFHSSRQSGWNACAAT
NGHCSHLCLAVPVCSFTCGCPAHYSLNTDNKTCSAPTSFLLFSQKTAINRMVMDELQSPD
IILPIHSLRNVRAIDYDPLDRHLYWIDAKQNVIRRAQEDGNQSVTVVSGAVGGSNLGLQP
YDLSIDIYSRFIYWTSELTNVINVTRTDGSRVGVVLRGEHDKPRAIAVNPERGYMYFSNL
QERSPKIERCALDGTEREVLFFSNLGRPVALAVDNELGKLFWVDMDLRRIESSDLSGANR
IVIEDSNILQPVGLTVFGNFLYWIDRQQQMIERIHKVTREGRTKIQARIASLSDIHAVHQ
LDMQEYSKHPCTSDNGGCTHICIVKGDGTTRCSCPIHLVLLQDELSCGEPPTCSPEQFSC
VSGEVDCIPQAWRCDGFAECDDSSDERDCPVCSSREFQCDSRQCVDAALRCNGEINCQDR
SDENKCEVLCPADQFTCSNGQCIGRHKKCDNNMDCTDNSDEIGCYATEEPSFAPTNTIGS
IVGVVMVLFVVGAVYFVCQRVLCPQMKDDADTMTNDFVVHGPPPVPLGYVPHPASLSGSL
PGMSRGKSVMGSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGAYFPPILNPPPSPATVRS
QYTMEFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYTPGRRAPHASSATAA
KGYASDLNYDSEPLPPPPTPRSQYLSAEENCESCPPSPYTERSYSHQLYPPPPSPCTDSS
Download sequence
Identical sequences B5L5I6
NP_001128156.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]