SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001128639.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001128639.1.92137
Domain Number 1 Region: 4-433
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-134
Family ALDH-like 0.00000000000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001128639.1.92137
Sequence length 453
Comment aldehyde dehydrogenase, dimeric NADP-preferring isoform 1 [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MSKISEAVKRARAAFSSGRTRPLQFRIQQLEALQRLIQEQEQELVGALAADLHKNEWNAY
YEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYIHSEPLGVVLVIGTWNYPFNL
TIQPMVGAIAAGNSVVLKPSELSENMASLLATIIPQYLDKDLYPVINGGVPETTELLKER
FDHILYTGSTGVGKIIMTAAAKHLTPVTLELGGKSPCYVDKNCDLDVACRRIAWGKFMNS
GQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRIISARHFQRVMGLIEG
QKVAYGGTGDAATRYIAPTILTDVDPQSPVMQEEIFGPVLPIVCVRSLEEAIQFINQREK
PLALYMFSSNDKVIKKMIAETSSGGVAANDVIVHITLHSLPFGGVGNSGMGSYHGKKSFE
TFSHRRSCLVRPLMNDEGLKVRYPPSPAKMTQH
Download sequence
Identical sequences P30838
ENSP00000225740 gi|206597439|ref|NP_001128639.1| gi|206597441|ref|NP_001128640.1| gi|22907049|ref|NP_000682.3| ENSP00000225740 ENSP00000388469 ENSP00000411821 NP_000682.3.87134 NP_000682.3.92137 NP_001128639.1.87134 NP_001128639.1.92137 NP_001128640.1.87134 NP_001128640.1.92137 9606.ENSP00000225740 ENSP00000225740 ENSP00000388469 ENSP00000411821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]