SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001128680.1.92137 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001128680.1.92137
Domain Number 1 Region: 31-136
Classification Level Classification E-value
Superfamily FKBP-like 8.54e-64
Family SCOPe 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001128680.1.92137
Sequence length 142
Comment peptidyl-prolyl cis-trans isomerase FKBP2 precursor [Homo sapiens]; AA=GCF_000001405.37; RF=reference genome; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Patch
Sequence
MRLSWFRVLTVLSICLSAVATATGAEGKRKLQIGVKKRVDHCPIKSRKGDVLHMHYTGKL
EDGTEFDSSLPQNQPFVFSLGTGQVIKGWDQGLLGMCEGEKRKLVIPSELGYGERGAPPK
IPGGATLVFEVELLKIERRTEL
Download sequence
Identical sequences P26885 Q53XJ5
9606.ENSP00000310935 NP_001128680.1.87134 NP_001128680.1.92137 NP_004461.2.87134 NP_004461.2.92137 NP_476433.1.87134 NP_476433.1.92137 XP_005273905.1.92137 4nnr_A 4nnr_B ENSP00000310935 ENSP00000378046 ENSP00000398147 gi|17149842|ref|NP_004461.2| gi|17149844|ref|NP_476433.1| gi|206725530|ref|NP_001128680.1| ENSP00000310935 ENSP00000378046 ENSP00000398147 ENSP00000310935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]