SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001129497.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001129497.1.87134
Domain Number 1 Region: 121-623
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.63e-162
Family Calponin-homology domain, CH-domain 0.00000000218
Further Details:      
 
Domain Number 2 Region: 5-142
Classification Level Classification E-value
Superfamily EF-hand 4.8e-17
Family Calmodulin-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001129497.1.87134
Sequence length 630
Comment plastin-3 isoform 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MDEMATTQISKDELDELKEAFAKVDLNSNGFICDYELHELFKEANMPLPGYKVREIIQKL
MLDGDRNKDGKISFDEFVYIFQEVKSSDIAKTFRKAINRKEGICALGGTSELSSEGTQHS
YSEEEKYAFVNWINKALENDPDCRHVIPMNPNTDDLFKAVGDGIVLCKMINLSVPDTIDE
RAINKKKLTPFIIQENLNLALNSASAIGCHVVNIGAEDLRAGKPHLVLGLLWQIIKIGLF
ADIELSRNEALAALLRDGETLEELMKLSPEELLLRWANFHLENSGWQKINNFSADIKDSK
AYFHLLNQIAPKGQKEGEPRIDINMSGFNETDDLKRAESMLQQADKLGCRQFVTPADVVS
GNPKLNLAFVANLFNKYPALTKPENQDIDWTLLEGETREERTFRNWMNSLGVNPHVNHLY
ADLQDALVILQLYERIKVPVDWSKVNKPPYPKLGANMKKLENCNYAVELGKHPAKFSLVG
IGGQDLNDGNQTLTLALVWQLMRRYTLNVLEDLGDGQKANDDIIVNWVNRTLSEAGKSTS
IQSFKDKTISSSLAVVDLIDAIQPGCINYDLVKSGNLTEDDKHNNAKYAVSMARRIGARV
YALPEDLVEVKPKMVMTVFACLMGRGMKRV
Download sequence
Identical sequences A0A096ML56 A0A2I3HT24 A0A2I3SU43 A0A2K5ERS2 A0A2K5IEX5 A0A2K5N091 A0A2K5XX95 A0A2K6CET1 A0A2K6PDH4 A0A2K6THH9 G7Q3I2 H2PWJ5 H9ZA70 P13797 U3DM73
ENSP00000348163 9544.ENSMMUP00000040861 9606.ENSP00000348163 ENSPPYP00000023116 NP_001129497.1.87134 NP_001129497.1.92137 NP_001253150.1.72884 NP_005023.2.87134 NP_005023.2.92137 XP_003262273.1.23891 XP_003262274.1.23891 XP_003805459.1.60992 XP_003805460.1.60992 XP_003935878.1.74449 XP_003935879.1.74449 XP_005594476.1.63531 XP_005594477.1.63531 XP_009233433.1.23681 XP_009233434.1.23681 XP_009233435.1.23681 XP_010344619.1.74449 XP_010354264.1.97406 XP_010354265.1.97406 XP_010354266.1.97406 XP_010354267.1.97406 XP_011535836.1.92137 XP_011754527.1.29376 XP_011754528.1.29376 XP_011754529.1.29376 XP_011754530.1.29376 XP_011754531.1.29376 XP_011754532.1.29376 XP_011754533.1.29376 XP_011812921.1.43180 XP_011812922.1.43180 XP_011839857.1.47321 XP_011839864.1.47321 XP_011943030.1.92194 XP_011943031.1.92194 XP_012307209.1.9421 XP_012307210.1.9421 XP_014983485.1.72884 XP_015299516.1.63531 XP_015299517.1.63531 XP_015299518.1.63531 XP_015299520.1.63531 XP_016798855.1.37143 XP_016798856.1.37143 XP_017823912.1.60252 ENSMMUP00000008409 ENSMMUP00000040861 ENSNLEP00000017887 ENSMMUP00000008409 ENSP00000348163 ENSP00000398945 ENSP00000472532 ENSP00000473121 gi|209862851|ref|NP_001129497.1| gi|7549809|ref|NP_005023.2| ENSP00000348163 ENSNLEP00000017887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]