SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001131077.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001131077.1.87134
Domain Number 1 Region: 19-163,208-316
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.74e-35
Family Calponin-homology domain, CH-domain 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001131077.1.87134
Sequence length 331
Comment gamma-parvin [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MEPEFLYDLLQLPKGVEPPAEEELSKGGKKKYLPPTSRKDPKFEELQKVLMEWINATLLP
EHIVVRSLEEDMFDGLILHHLFQRLAALKLEAEDIALTATSQKHKLTVVLEAVNRSLQLE
EWQAKWSVESIFNKDLLSTLHLLVALAKRFQPDLSLPTNVQVEVITIESTKSGLKSEKLV
EQLTEYSTDKDEPPKDVFDELFKLAPEKVNAVKEAIVNFVNQKLDRLGLSVQNLDTQFAD
GVILLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVSPEDIVNK
DAKSTLRVLYGLFCKHTQKAHRDRTPHGAPN
Download sequence
Identical sequences A0A024R4U4 Q9HBI0
NP_001131077.1.87134 NP_001131077.1.92137 NP_071424.1.87134 NP_071424.1.92137 XP_005261759.1.92137 ENSP00000391453 ENSP00000391583 GO.33880 gi|11545879|ref|NP_071424.1| gi|212286179|ref|NP_001131077.1| gi|212286181|ref|NP_001131078.1| ENSP00000349378 ENSP00000391453 ENSP00000391583 ENSP00000416761 9606.ENSP00000388613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]