SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001137299.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001137299.1.87134
Domain Number 1 Region: 32-161
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.14e-49
Family Calponin-homology domain, CH-domain 0.000000574
Further Details:      
 
Domain Number 2 Region: 231-291
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.96e-19
Family EB1 dimerisation domain-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) NP_001137299.1.87134
Sequence length 315
Comment microtubule-associated protein RP/EB family member 2 isoform 3 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MKQNRDQKCPVSQRNSSFQQPGRKPGCSSWGMAVNVYSTSITQETMSRHDIIAWVNDIVS
LNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDK
VIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLP
KKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVH
SLKLALEGVEKERDFYFGKLREIELLCQEHGQENDDLVQRLMDILYASEEHEGHTEEPEA
EEQAHEQQPPQQEEY
Download sequence
Identical sequences NP_001137299.1.87134 NP_001137299.1.92137 gi|219842327|ref|NP_001137299.1| ENSP00000407723 ENSP00000407723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]