SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001139267.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001139267.1.87134
Domain Number 1 Region: 267-381
Classification Level Classification E-value
Superfamily PH domain-like 2.72e-32
Family Pleckstrin-homology domain (PH domain) 0.00008
Further Details:      
 
Domain Number 2 Region: 524-627
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-25
Family SH2 domain 0.0000127
Further Details:      
 
Domain Number 3 Region: 24-83
Classification Level Classification E-value
Superfamily Phenylalanine zipper 6.28e-22
Family Adapter protein APS, dimerisation domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001139267.1.87134
Sequence length 756
Comment SH2B adapter protein 1 isoform 1 [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MNGAPSPEDGASPSSPPLPPPPPPSWREFCESHARAAALDFARRFRLYLASHPQYAGPGA
EAAFSRRFAELFLQHFEAEVARASGSLSPPILAPLSPGAEISPHDLSLESCRVGGPLAVL
GPSRSSEDLAGPLPSSVSSSSTTSSKPKLKKRFSLRSVGRSVRGSVRGILQWRGTVDPPS
SAGPLETSSGPPVLGGNSNSNSSGGAGTVGRGLVSDGTSPGERWTHRFERLRLSRGGGAL
KDGAGMVQREELLSFMGAEEAAPDPAGVGRGGGVAGPPSGGGGQPQWQKCRLLLRSEGEG
GGGSRLEFFVPPKASRPRLSIPCSSITDVRTTTALEMPDRENTFVVKVEGPSEYIMETVD
AQHVKAWVSDIQECLSPGPCPATSPRPMTLPLAPGTSFLTRENTDSLELSCLNHSESLPS
QDLLLGPSESNDRLSQGAYGGLSDRPSASISPSSASIAASHFDSMELLPPELPPRIPIEE
GPPTGTVHPLSAPYPPLDTPETATGSFLFQGEPEGGEGDQPLSGYPWFHGMLSRLKAAQL
VLTGGTGSHGVFLVRQSETRRGEYVLTFNFQGKAKHLRLSLNEEGQCRVQHLWFQSIFDM
LEHFRVHPIPLESGGSSDVVLVSYVPSSQRQQEPTTSHDPPQPPEPPSWTDPPQPGAEEA
SRAPEVAAAAAAAAKERQEKEKAGGGGVPEELVPVVELVPVVELEEAIAPGSEAQGAGSG
GDAGVPPMVQLQQSPLGGDGEEGGHPRAINNQYSFV
Download sequence
Identical sequences A0A024QZD2 Q9NRF2
ENSP00000321221 ENSP00000481709 NP_001139267.1.87134 NP_001139267.1.92137 NP_001295222.1.87134 NP_001295222.1.92137 XP_016878603.1.92137 XP_016878604.1.92137 XP_016878605.1.92137 gi|224926826|ref|NP_001139267.1| ENSP00000321221 ENSP00000321221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]