SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001139389.1.52716 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001139389.1.52716
Domain Number 1 Region: 64-171
Classification Level Classification E-value
Superfamily Phospholipase A2, PLA2 2.23e-32
Family Insect phospholipase A2 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001139389.1.52716
Sequence length 173
Comment phospholipase A2A [Tribolium castaneum]; AA=GCF_000002335.3; RF=representative genome; TAX=7070; STAX=7070; NAME=Tribolium castaneum; strain=Georgia GA2; AL=Chromosome; RT=Major
Sequence
MWEVFRTQYHTKMRYFFPFVIFSLIYGKSNCVQIIWDNNVDFDSVEVEELGRSDQVRMPN
WFFIFPGTKWCGAGNIAEDENDFGEFRDTDKCCRNHDLCPDIIEGYQSKHNLTNPSFFTR
LNCECDEEFHKCLKSVNSRVSTQIGQIYFTALGTQCYREDYPIVSCKKYSYLP
Download sequence
Identical sequences C0LTQ1
7070.C0LTQ1 NP_001139389.1.52716 TC002563

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]