SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001140095.1.97760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001140095.1.97760
Domain Number 1 Region: 101-195
Classification Level Classification E-value
Superfamily PDZ domain-like 4.34e-30
Family PDZ domain 0.012
Further Details:      
 
Domain Number 2 Region: 22-76
Classification Level Classification E-value
Superfamily L27 domain 3.41e-22
Family L27 domain 0.0000932
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001140095.1.97760
Sequence length 220
Comment protein lin-7 homolog B [Salmo salar]; AA=GCF_000233375.1; RF=representative genome; TAX=8030; STAX=8030; NAME=Salmo salar; breed=double haploid; AL=Chromosome; RT=Major
Sequence
MMSSYYHSGKETDMATMTEPLCLERDVCRVIELLDRLQRSGELPPPKLQALQRVLQSKFC
AAIREVYEQLYDTLDIVGGPEVRAQATAKATVAAFAASEGHAHPRVVELPKTEEGLGFNI
MGGKEQNSPIYISRVIPGGVADRQGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAQGSV
KLVVRYTPKVLEEMEARFEKMRSARRRQQHTSYSSLESRG
Download sequence
Identical sequences B9EQ44
NP_001140095.1.97760 XP_020341693.1.87700 XP_021480036.1.32639

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]