SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001162580.1.87134 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001162580.1.87134
Domain Number 1 Region: 102-261
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.35e-49
Family Glutathione peroxidase-like 0.00000324
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001162580.1.87134
Sequence length 266
Comment protein SCO2 homolog, mitochondrial precursor [Homo sapiens]; AA=GCF_000306695.2; RF=na; TAX=9606; STAX=9606; NAME=Homo sapiens; AL=Chromosome; RT=Major
Sequence
MLLLTRSPTAWHRLSQLKPRVLPGTLGGQALHLRSWLLSRQGPAETGGQGQPQGPGLRTR
LLITGLFGAGLGGAWLALRAEKERLQQQKRTEALRQAAVGQGDFHLLDHRGRARCKADFR
GQWVLMYFGFTHCPDICPDELEKLVQVVRQLEAEPGLPPVQPVFITVDPERDDVEAMARY
VQDFHPRLLGLTGSTKQVAQASHSYRVYYNAGPKDEDQDYIVDHSIAIYLLNPDGLFTDY
YGRSRSAEQISDSVRRHMAAFRSVLS
Download sequence
Identical sequences O43819
NP_001162580.1.87134 NP_001162580.1.92137 NP_001162581.1.87134 NP_001162581.1.92137 NP_001162582.1.87134 NP_001162582.1.92137 NP_005129.2.87134 NP_005129.2.92137 gi|153791313|ref|NP_005129.2| gi|281182716|ref|NP_001162580.1| gi|281182722|ref|NP_001162581.1| gi|281182727|ref|NP_001162582.1| ENSP00000252785 ENSP00000252785 ENSP00000379046 ENSP00000444242 ENSP00000444433 9606.ENSP00000252785 ENSP00000252785 ENSP00000379046 ENSP00000444242 ENSP00000444433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]