SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for NP_001166133.1.86415 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001166133.1.86415
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.3e-44
Family G proteins 0.0000221
Further Details:      
 
Domain Number 2 Region: 189-228
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000000000785
Family SOCS box-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) NP_001166133.1.86415
Sequence length 281
Comment RAB40C, member RAS oncogene family [Gallus gallus]; AA=GCF_000002315.4; RF=representative genome; TAX=9031; STAX=9031; NAME=Gallus gallus; breed=Red Jungle fowl, inbred line UCD001; AL=Chromosome; RT=Major
Sequence
MGTQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGASESPYAYSNGIDYKTTTILLDG
RRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVP
RILVGNRLHLAFKRQVPTEQARAYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHGM
EKIWRPNRVFSLQDLCCRAIVSCTPVHLIDKLPLPVTIKSHLKSFSMANGMNAVMMHGRS
YSLASSGGGSSSKGNSLKRSKSIRPPQSPPQNCSRNNCKIS
Download sequence
Identical sequences A0A091FL88 A0A091QXV2 A0A093BNP5 A0A093HL77 A0A099Z419 A0A151N751 A0A1D5P1F5 A0A226MVC7 U3JQ29
ENSFALP00000004883 ENSGALP00000042158 NP_001166133.1.86415 XP_005054281.1.66865 XP_005150723.1.78019 XP_009569298.1.62272 XP_009953854.1.99599 XP_009993747.1.85724 XP_010210386.1.20684 XP_012431960.1.42559 XP_014744035.1.99236 XP_017664265.1.3805 XP_021267233.1.32913

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]