SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for NP_001170123.1.34533 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  NP_001170123.1.34533
Domain Number 1 Region: 141-248
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.29e-42
Family B3 DNA binding domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) NP_001170123.1.34533
Sequence length 708
Comment uncharacterized protein LOC100384045 [Zea mays]; AA=GCF_000005005.2; RF=representative genome; TAX=4577; STAX=4577; NAME=Zea mays; cultivar=B73; AL=Chromosome; RT=Major
Sequence
MAGIDLNTVEEEDEEEAEALPLPGPGGRGAVCLELWHACAGPVPPLPRKGSAVVYLPQGH
LEHIGGDAARGAAASAVPPHVLCRVVDVTLHADGATDEVYARVSLLPEDEDAEKRAQAQA
RVREDEDRRDGEDGGAMRPLARTPHMFCKTLTASDTSTHGGFSVPRRAAEDCFPPLDYSQ
QRPSQELVAKDLHGTEWKFRHIYRGQPRRHLLTTGWSAFVNRKKLISGDAVLFLRGEDGV
LRLGVRRAAQLKIVTPIPAPHNQCSSNSNLGNVAQAVATKTVFHIYYNPRLTQSEFIVPY
WKFTRSFNQPISVGMRCRMRYESDDASERRCTGIIIGSREADPIWYGSKWKCLVVRWDDG
IECRWPNRVSPWEIELTGSVSGSQMCAPSSKRLKPCLPQVNPEIVLPNGSVSSDFAGSAR
FHKVLQGQELLGFKTHDGPAISASQATEARNLQYSDERSNNNLGIPRLGVRSPTGIPGFP
YHCSGFGESQRFQKVLQGQEVFHPFRGGCLADGHIRTAGMYQPDGRHVSGAAYKWSAPQG
YDFPQPAKPVFLLQESSPSSVMMFPQTRSKITHLEYEYSRHEDGRLDRTVPTQDMGRSNQ
TLSLWPHLVSGEAIEECTGTVNMHSPVSGAEHESNNESTVENGCKIFGISLAEKIRSCDE
ADSCSAKCNSRLQPLKSQMPKSLGSCWATVHEQRPVVGRVVDVSATDM
Download sequence
Identical sequences C0PL36 K0D9R5
GRMZM2G437460_T01|PACid:20826469 GRMZM2G437460_P02 NP_001170123.1.34533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]